PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof003339
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HD-ZIP
Protein Properties Length: 250aa    MW: 27931 Da    PI: 8.8601
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-18930PU_refplantGDBView CDS
gnl|UG|Sof#S17268347PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.9e-1969121456
                -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                ++++ +eq+++Le++Fe +++++ ++++++A+ l L+ rqV vWFqNrRa++k
  Sof003339  69 KRRLLQEQVRALERCFETDNKLDPDRKARIARDLALQPRQVAVWFQNRRARWK 121
                456789**********************************************9 PP

2HD-ZIP_I/II124.54.9e-4067159193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrl +eqv++LE++Fe+++kL+p+rK+++ar+L lqprqvavWFqnrRAR+ktk lE+d++aL++++dal+++ ++L++++++L++e++e
    Sof003339  67 EKKRRLLQEQVRALERCFETDNKLDPDRKARIARDLALQPRQVAVWFQNRRARWKTKTLERDFAALRARHDALRADCDALRHDKDALAAEIRE 159
                  69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.71E-1765123IPR009057Homeodomain-like
SMARTSM003892.6E-1766127IPR001356Homeobox domain
PROSITE profilePS5007115.93767123IPR001356Homeobox domain
CDDcd000863.37E-1468123No hitNo description
PfamPF000464.1E-1669121IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.8E-1974122IPR009057Homeodomain-like
PROSITE patternPS00027098121IPR017970Homeobox, conserved site
PfamPF021831.8E-13123164IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MKRQSKRPTA SRESPETGEK LAFAEEVALT ARKMETDEAE MDDVDEEDED ELAGRRAART  60
SSCGLGEKKR RLLQEQVRAL ERCFETDNKL DPDRKARIAR DLALQPRQVA VWFQNRRARW  120
KTKTLERDFA ALRARHDALR ADCDALRHDK DALAAEIREL RQKLLSKAPE AAVXLEATTG  180
NDTAEEERQT TGDAPPRGGL ARTAPSEQRT PSVGLPTTVE GRRPYSGARG SGASPGLPFG  240
FRLKPFLGNY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.54270.0callus| inflorescence| leaf| root| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465732.11e-103hypothetical protein SORBIDRAFT_01g044620
SwissprotQ10QP35e-66HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLC5WUU61e-103C5WUU6_SORBI; Putative uncharacterized protein Sb01g044620
STRINGSb01g044620.11e-103(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.17e-27homeobox protein 5